Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit anti-JUNB (Phospho-Ser259) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human JunBaround the phosphorylation site of serine 259 (P-V-SP-P-I). |
| Modifications | Phospho-specific |
Rabbit Polyclonal JunB Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human JunB |
Rabbit Polyclonal JunB (Ser259) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human JunB around the phosphorylation site of Serine 259 |
| Modifications | Phospho-specific |
JunB Rabbit polyclonal Antibody
| Applications | IF, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthesized peptide derived from human JunB |
JunB Rabbit monoclonal Antibody
| Applications | IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Goat Anti-JUNB Antibody
| Applications | WB |
| Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Cow, Dog) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-TLKAENAGLSSTAG, from the internal region of the protein sequence according to NP_002220.1. |
Rabbit Polyclonal Anti-JUNB Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-JUNB antibody: synthetic peptide directed towards the N terminal of human JUNB. Synthetic peptide located within the following region: MCTKMEQPFYHDDSYTATGYGRAPGGLSLHDYKLLKPSLAVNLADPYRSL |
Rabbit Polyclonal Anti-JUNB Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-JUNB antibody: synthetic peptide directed towards the C terminal of human JUNB. Synthetic peptide located within the following region: EEPQTVPEARSRDATPPVSPINMEDQERIKVERKRLRNRLAATKCRKRKL |
Rabbit Polyclonal Anti-JUNB Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-JUNB Antibody: synthetic peptide directed towards the N terminal of human JUNB. Synthetic peptide located within the following region: YGRAPGGLSLHDYKLLKPSLAVNLADPYRSLKAPGARGPGPEGGGGGSYF |
Rabbit Polyclonal Anti-JUNB Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-JUNB Antibody: synthetic peptide directed towards the C terminal of human JUNB. Synthetic peptide located within the following region: VERKRLRNRLAATKCRKRKLERIARLEDKVKTLKAENAGLSSTAGLLREQ |
JunB Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human JunB (NP_002220.1). |
| Modifications | Unmodified |
JunB Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-240 of human JunB (NP_002220.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- JUNB
Reactivities
- Human
Applications
- WB
Isotypes
- IgG