Antibodies

Jump to Filters
View as table Download
Glutamine Synthetase (GLUL) Rabbit Polyclonal Antibody
TA350024

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-GLUL Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human GLUL
Glutamine Synthetase (GLUL) Rabbit Polyclonal Antibody
TA301447

USD 550.00

5 Days

Rabbit Polyclonal Antibody against Glutamine Synthase

Applications ICC/IF, IHC, WB
Reactivities Bovine, Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein.
Glutamine Synthetase (GLUL) Rabbit Polyclonal Antibody
TA332686

USD 450.00

3 Weeks

Rabbit anti-GLUL Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human GLUL
Glutamine Synthetase (GLUL) Rabbit Polyclonal Antibody
RA25062-100

USD 665.00

2 Weeks

Glutamine Synthetase (GLUL) rabbit polyclonal antibody

Applications IHC, WB
Reactivities Bovine, Human, Mouse, Rat
Conjugation Unconjugated
Glutamine Synthetase (GLUL) Rabbit Polyclonal Antibody
TA342667

USD 539.00

5 Days

Rabbit Polyclonal Anti-GLUL Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GLUL antibody: synthetic peptide directed towards the C terminal of human GLUL. Synthetic peptide located within the following region: TGFHETSNINDFSAGVANRSASIRIPRTVGQEKKGYFEDRRPSANCDPFS