Antibodies

View as table Download

Rabbit Polyclonal Anti-Ppp2r2d Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Ppp2r2d Antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: RRDVTLEASRENSKPRASLKPRKVCTGGKRKKDEISVDSLDFNKKILHTA

Rabbit Polyclonal Anti-Ppp2r2a Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Ppp2r2a Antibody is: synthetic peptide directed towards the C-terminal region of Rat Ppp2r2a. Synthetic peptide located within the following region: ASRENNKPRTVLKPRKVCASGKRKKDEISVDSLDFNKKILHTAWHPKENI