Antibodies

Jump to Filters
View as table Download
GRK3 Rabbit Polyclonal Antibody
TA327241

USD 365.00

3 Weeks

ADRBK2 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ADRBK2
GRK3 Rabbit Polyclonal Antibody
TA312914

USD 380.00

4 Weeks

Rabbit polyclonal anti-GRK3 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen he antiserum was produced against synthesized peptide derived from internal of human GRK3.
GRK3 Rabbit Polyclonal Antibody
TA340058

USD 539.00

5 Days

Rabbit Polyclonal Anti-ADRBK2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ADRBK2 antibody: synthetic peptide directed towards the N terminal of human ADRBK2. Synthetic peptide located within the following region: FCLNEINEAVPQVKFYEEIKEYEKLDNEEDRLCRSRQIYDAYIMKELLSC