Rabbit Polyclonal Anti-GSTA3 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human GSTA3 |
Rabbit Polyclonal Anti-GSTA3 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human GSTA3 |
Rabbit Polyclonal Anti-GSTA3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GSTA3 antibody: synthetic peptide directed towards the middle region of human GSTA3. Synthetic peptide located within the following region: SSLISNFPLLKALKTRISNLPTVKKFLQPGSPRKPPADAKALEEARKIFR |