Antibodies

Jump to Filters

View as table

Loading...

Download Close

Download

1 - 2 of 2 results

(reset)

YARS2 Rabbit Polyclonal Antibody

TA349599

USD 380.00

In Stock

Rabbit Polyclonal Anti-YARS2 Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Fusion protein of human YARS2

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

YARS2 Rabbit Polyclonal Antibody

TA332234

USD 539.00

5 Days

Rabbit Polyclonal Anti-YARS2 Antibody

Applications	WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for Anti-YARS2 Antibody is: synthetic peptide directed towards the C-terminal region of Human YARS2. Synthetic peptide located within the following region: QPDDSVERYLKLFTFLPLPEIDHIMQLHVKEPERRGPQKRLAAEVTKLVH

1 - 2 of 2 results