Antibodies

Jump to Filters
View as table Download
IFNGR2 Mouse Monoclonal Antibody [Clone ID: OTI1C2]
TA506734

USD 447.00

In Stock

IFNGR2 mouse monoclonal antibody, clone OTI1C2 (formerly 1C2)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
IFNGR2 Mouse Monoclonal Antibody [Clone ID: OTI1C2]
CF506734

USD 600.00

3 Days

Carrier-free (BSA/glycerol-free) IFNGR2 mouse monoclonal antibody, clone OTI1C2 (formerly 1C2)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
IFNGR2 Rabbit Polyclonal Antibody
TA351278

USD 380.00

In Stock

Rabbit Polyclonal Anti-IFNGR2 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human IFNGR2
IFNGR2 (C-term) Rabbit Polyclonal Antibody
AP17492PU-N

USD 580.00

2 Weeks

IFNGR2 (C-term) rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide selected from the C-terminal region of human IFNGR2
IFNGR2 Rabbit Polyclonal Antibody
TA339011

USD 539.00

5 Days

Rabbit Polyclonal Anti-IFNGR2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IFNGR2 antibody: synthetic peptide directed towards the middle region of human IFNGR2. Synthetic peptide located within the following region: WEKGGIQQVKGPFRSNSISLDNLKPSRVYCLQVQAQLLWNKSNIFRVGHL