Germany
Japan
United Kingdom
China
Rabbit anti-UGT1A1 Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human UGT1A1 |
Antibodies
View as table Download
Rabbit Polyclonal antibody to UGT1A9 (UDP glucuronosyltransferase 1 family, polypeptide A9)
| Applications | IHC, WB |
| Reactivities | Human, Mouse (Predicted: Rat) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 291 and 530 of UGT1A9 (Uniprot ID#O60656) |
Rabbit Polyclonal Anti-HSD11B1 Antibody
| Applications | IHC, WB |
| Reactivities | Rat, Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HSD11B1 antibody: synthetic peptide directed towards the N terminal of human HSD11B1. Synthetic peptide located within the following region: QKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHI |
UGT1A9 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human UGT1A9 |
Rabbit anti-UGT2B7 Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human UGT2B7 |
Goat Anti-SRD5A2 Antibody
| Applications | WB |
| Reactivities | Human (Expected from sequence similarity: Rat, Dog, Pig) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-KMFEDYPKSRK, from the C Terminus of the protein sequence according to NP_000339.2. |
Rabbit anti-HSD17B2 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human HSD17B2 |
Active filters
Reactivities
- Rat
Applications
- WB
Families
- Transmembrane
Pathways
- Androgen and estrogen metabolism