Antibodies

Jump to Filters
View as table Download
Frizzled 4 (FZD4) Rabbit Polyclonal Antibody
TA321813

USD 380.00

In Stock

Anti-FZD4 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 37-222 amino acids of human frizzled family receptor 4
Frizzled 4 (FZD4) Rabbit Polyclonal Antibody
TA344072

USD 539.00

5 Days

Rabbit Polyclonal Anti-FZD4 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FZD4 antibody: synthetic peptide directed towards the middle region of human FZD4. Synthetic peptide located within the following region: GITSGMWIWSAKTLHTWQKCSNRLVNSGKVKREKRGNGWVKPGKGSETVV
Frizzled 4 (FZD4) Rabbit Polyclonal Antibody
TA321814

USD 380.00

In Stock

Anti-FZD4 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 37-222 amino acids of human frizzled family receptor 4
TA321814 is a possible alternative to TA321813.
Frizzled 4 (FZD4) Goat Polyclonal Antibody
TA303333

USD 520.00

2 Weeks

Goat Polyclonal Antibody against FZD4

Applications WB
Reactivities Human (Expected from sequence similarity: Rat)
Conjugation Unconjugated
Immunogen Peptide with sequence DEEERRCDPIRIS, from the internal region of the protein sequence according to NP_036325.2.