Antibodies

View as table Download

Rabbit polyclonal Cytochrome P450 8B1 antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 8B1.

Anti-OLR1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 2-15 amino acids of Human oxidized low density lipoprotein (lectin-like) receptor 1

Rabbit Polyclonal Anti-ACSL3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ACSL3 antibody: synthetic peptide directed towards the N terminal of human ACSL3. Synthetic peptide located within the following region: LDGLASVLYPGCDTLDKVFTYAKNKFKNKRLLGTREVLNEEDEVQPNGKI

Rabbit polyclonal ACSL4 (FACL4) Antibody (Center)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This ACSL4 (FACL4) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 236-267 amino acids from the Central region of human ACSL4 (FACL4).

Rabbit Polyclonal Anti-ACSL1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ACSL1 antibody: synthetic peptide directed towards the C terminal of human ACSL1. Synthetic peptide located within the following region: GSFEELCRNKDVKKAILEDMVRLGKDSGLKPFEQVKGITLHPELFSIDNG

Rabbit Polyclonal Anti-ACSL4 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human ACSL4

Rabbit Polyclonal Anti-OLR1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human OLR1

Rabbit Polyclonal Antibody against CD36

Applications ICC/IF, IHC, WB
Reactivities Human, Bovine, Monkey
Conjugation Unconjugated
Immunogen A synthetic peptide mapping to a region of human CD36 between residues 100-200.

Rabbit Polyclonal Anti-SLC27A2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SLC27A2 Antibody: synthetic peptide directed towards the N terminal of human SLC27A2. Synthetic peptide located within the following region: LLFRDETLTYAQVDRRSNQVARALHDHLGLRQGDCVALLMGNEPAYVWLW

Mouse anti-SCD1 (Stearoyl-CoA desaturase) monoclonal antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
TA309938 is a replacement of AM20836PU-N.

Goat Polyclonal Antibody against CPT1A

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-DPAQTVEQRLKLFK, from the internal region of the protein sequence according to NP_001867.2; NP_001027017.1.

Rabbit Polyclonal Antibody against CD36

Applications FC, ICC/IF, IHC, Immunoblotting, SDS-PAGE, Simple Western, WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide mapping to a region of human CD36 between residues 300-400.

Rabbit Polyclonal Anti-CPT1B Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-CPT1B antibody: synthetic peptide directed towards the middle region of human CPT1B. Synthetic peptide located within the following region: DLEMQFQRILDDPSPPQPGEEKLAALTAGGRVEWAQARQAFFSSGKNKAA

Rabbit polyclonal anti-SLC27A5 antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human SLC27A5.

Rabbit anti-CPT1A Polyclonal Antibody

Applications ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human CPT1A