Antibodies

Jump to Filters
View as table Download
PTGIS Rabbit Polyclonal Antibody
TA314405

USD 380.00

2 Weeks

Rabbit polyclonal anti-PTGIS antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human PTGIS.
PTGIS Rabbit Polyclonal Antibody
TA335273

USD 539.00

5 Days

Rabbit Polyclonal Anti-PTGIS Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PTGIS antibody: synthetic peptide directed towards the middle region of human PTGIS. Synthetic peptide located within the following region: EIYTDPEVFKYNRFLNPDGSEKKDFYKDGKRLKNYNMPWGAGHNHCLGRS