Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal anti-ZNF147 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ZNF147. |
TRIM25 rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide, corresponding to amino acids 360-418 of Human EFP. |
Rabbit polyclonal TRIM25 Antibody (Center)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This TRIM25 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 277-306 amino acids from the Central region of human TRIM25. |
Rabbit Polyclonal Anti-TRIM25 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TRIM25 antibody: synthetic peptide directed towards the middle region of human TRIM25. Synthetic peptide located within the following region: TPSSGDPGEHDPASTHKSTRPVKKVSKEEKKSKKPPPVPALPSKLPTFGA |
Rabbit Polyclonal Anti-TRIM25 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TRIM25 antibody: synthetic peptide directed towards the middle region of human TRIM25. Synthetic peptide located within the following region: LLDASETTSTRKIKEEEKRVNSKFDTIYQILLKKKSEIQTLKEEIEQSLT |
TRIM25 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of human TRIM25 |
Active filters
Category
-
Antibodies
- Primary Antibodies
Target Symbol
- TRIM25
Applications
- WB
Families
- Transcription Factors
Pathways
- RIG-I-like receptor signaling pathway