Germany
Japan
United Kingdom
China
Antibodies
View as table Download
USD 509.00
2 Weeks
POLR3H mouse monoclonal antibody,clone OTI5A12
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) POLR3H mouse monoclonal antibody,clone OTI5A12
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 509.00
2 Weeks
POLR3H mouse monoclonal antibody,clone OTI5A12, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
POLR3H mouse monoclonal antibody,clone OTI5A12, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
POLR3H mouse monoclonal antibody,clone OTI4D8
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit polyclonal anti-POLR3H (RPC8) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human RPC8. |
Rabbit Polyclonal Anti-POLR3H Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-POLR3H antibody: synthetic peptide directed towards the middle region of human POLR3H. Synthetic peptide located within the following region: AHDLYMDTGEEIRFRVVDESFVDTSPTGPSSADATTSSEELPKKEAPYTL |
POLR3H mouse monoclonal antibody,clone OTI5A12
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Active filters
Target Symbol
- POLR3H
Reactivities
- Human
Applications
- WB
Families
- Transcription Factors
Pathways
- Purine metabolism