Antibodies

Jump to Filters
View as table Download
HPRT (HPRT1) Mouse Monoclonal Antibody [Clone ID: OTI1B1]
TA506952

USD 447.00

In Stock

HPRT1 mouse monoclonal antibody, clone OTI1B1 (formerly 1B1)

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
HPRT (HPRT1) Mouse Monoclonal Antibody [Clone ID: OTI1B1]
CF506952

USD 600.00

3 Days

Carrier-free (BSA/glycerol-free) HPRT1 mouse monoclonal antibody, clone OTI1B1 (formerly 1B1)

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
HPRT (HPRT1) Rabbit Polyclonal Antibody
TA332846

USD 450.00

3 Weeks

Rabbit anti-HPRT1 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human HPRT1
HPRT (HPRT1) Rabbit Polyclonal Antibody
TA346669

USD 539.00

5 Days

Rabbit Polyclonal Anti-HPRT1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-HPRT1 antibody: synthetic peptide directed towards the middle region of human HPRT1. Synthetic peptide located within the following region: STGDIKVIGGDDLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVK
HPRT (HPRT1) Mouse Monoclonal Antibody [Clone ID: OTI1B1]
TA506952S

USD 200.00

2 Days

HPRT1 mouse monoclonal antibody, clone OTI1B1 (formerly 1B1)

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".