Antibodies

Jump to Filters
View as table Download
Syntaxin 3 (STX3) Rabbit Polyclonal Antibody
TA351776

USD 380.00

In Stock

Rabbit Polyclonal Anti-STX3 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human STX3
VAMP8 Rabbit Polyclonal Antibody
TA342644

USD 539.00

5 Days

Rabbit Polyclonal Anti-VAMP8 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Vamp8 antibody is: synthetic peptide directed towards the middle region of Rat Vamp8. Synthetic peptide located within the following region: LDHLRNKTEDLEATSEHFKTTSQKVARKFWWKNVKMIVIICVIVLIILIL