Rabbit polyclonal TK (Ab-13) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human TK around the phosphorylation site of serine 13 (P-G-SP-P-S). |
Rabbit polyclonal TK (Ser13) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human TK around the phosphorylation site of serine 13 (P-G-SP-P-S). |
| Modifications | Phospho-specific |
Rabbit Polyclonal TK (Ser13) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human TK around the phosphorylation site of Serine 13 |
| Modifications | Phospho-specific |
Rabbit Polyclonal TK Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human TK |
Rabbit anti-HPRT1 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human HPRT1 |
Rabbit Polyclonal Anti-HPRT1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HPRT1 antibody: synthetic peptide directed towards the middle region of human HPRT1. Synthetic peptide located within the following region: STGDIKVIGGDDLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVK |
Germany
Japan
United Kingdom
China
