Antibodies

Jump to Filters
View as table Download
RANTES (CCL5) Mouse Monoclonal Antibody [Clone ID: OTI2A7]
TA806330

USD 447.00

In Stock

CCL5 mouse monoclonal antibody, clone OTI2A7 (formerly 2A7)

Applications WB
Reactivities Human
Conjugation Unconjugated
RANTES (CCL5) Mouse Monoclonal Antibody [Clone ID: OTI10G5]
TA806662

USD 447.00

In Stock

CCL5 mouse monoclonal antibody, clone OTI10G5 (formerly 10G5)

Applications WB
Reactivities Human
Conjugation Unconjugated
RANTES (CCL5) Rabbit Polyclonal Antibody
AP20618PU-N

USD 445.00

3 Weeks

RANTES (CCL5) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to amino acids 50-100 of Human RANTES.
RANTES (CCL5) Mouse Monoclonal Antibody [Clone ID: OTI2A7]
CF806330

USD 600.00

3 Days

Carrier-free (BSA/glycerol-free) CCL5 mouse monoclonal antibody, clone OTI2A7 (formerly 2A7)

Applications WB
Reactivities Human
Conjugation Unconjugated
RANTES (CCL5) Mouse Monoclonal Antibody [Clone ID: OTI10G5]
CF806662

USD 600.00

3 Days

Carrier-free (BSA/glycerol-free) CCL5 mouse monoclonal antibody, clone OTI10G5 (formerly 10G5)

Applications WB
Reactivities Human
Conjugation Unconjugated
RANTES (CCL5) Rabbit Polyclonal Antibody
TA332802

USD 365.00

3 Weeks

Rabbit anti-CCL5 Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein of human CCL5
RANTES (CCL5) Rabbit Polyclonal Antibody
TA342306

USD 485.00

5 Days

Rabbit Polyclonal Anti-CCL5 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-CCL5 antibody: synthetic peptide directed towards the middle region of mouse CCL5. Synthetic peptide located within the following region: YGSDTTPCCFAYLSLELPRAHVKEYFYTSSKCSNLAVVFVTRRNRQVCAN