Germany
Japan
United Kingdom
China
Antibodies
View as table Download
USD 509.00
2 Weeks
USD 509.00
2 Weeks
USD 509.00
2 Weeks
USD 509.00
2 Weeks
Rabbit polyclonal antibody to Amphiphysin (amphiphysin)
| Applications | IHC, WB |
| Reactivities | Human (Predicted: Pig, Bovine) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 194 of Amphiphysin (Uniprot ID#P49418) |
Rabbit Polyclonal Anti-GSN Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-GSN Antibody: synthetic peptide directed towards the C terminal of human GSN. Synthetic peptide located within the following region: KPMIIYKGGTSREGGQTAPASTRLFQVRANSAGATRAVEVLPKAGALNSN |
FCGR3A mouse monoclonal antibody, clone OTI2A2
| Applications | FC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
FCGR3A mouse monoclonal antibody, clone OTI12D8
| Applications | FC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit polyclonal AMPH antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human AMPH. |
Active filters
Applications
- WB
Families
- Secreted Protein
Pathways
- Fc gamma R-mediated phagocytosis