Antibodies

Jump to Filters
View as table Download
Synaptotagmin V (SYT5) Rabbit Polyclonal Antibody
TA322890

USD 380.00

In Stock

Anti-SYT5 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 46-200 amino acids of human synaptotagmin V
Synaptotagmin V (SYT5) Rabbit Polyclonal Antibody
TA322891

USD 380.00

4 Weeks

Anti-SYT5 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 46-200 amino acids of human synaptotagmin V
Synaptotagmin V (SYT5) Rabbit Polyclonal Antibody
TA342628

USD 539.00

5 Days

Rabbit Polyclonal Anti-SYT5 Antibody

Applications IHC, WB
Reactivities Mouse, Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SYT5 antibody: synthetic peptide directed towards the middle region of human SYT5. Synthetic peptide located within the following region: YLLPDKRRRYETKVHRQTLNPHFGETFAFKVPYVELGGRVLVMAVYDFDR