Antibodies

View as table Download

Rabbit anti-LIPC Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein of human LIPC

Rabbit Polyclonal Anti-LIPC Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LIPC antibody is: synthetic peptide directed towards the C-terminal region of LIPC. Synthetic peptide located within the following region: LKTIRVKAGETQQRMTFCSENTDDLLLRPTQEKIFVKCEIKSKTSKRKIR