CNDP2 mouse monoclonal antibody, clone OTI8A2 (formerly 8A2)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
CNDP2 mouse monoclonal antibody, clone OTI8A2 (formerly 8A2)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
CNDP2 mouse monoclonal antibody, clone OTI6D3 (formerly 6D3)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CNDP2 mouse monoclonal antibody, clone OTI8A2 (formerly 8A2)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CNDP2 mouse monoclonal antibody, clone OTI6D3 (formerly 6D3)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 509.00
2 Weeks
CNDP2 mouse monoclonal antibody, clone OTI8A2 (formerly 8A2), Biotinylated
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
CNDP2 mouse monoclonal antibody, clone OTI8A2 (formerly 8A2), HRP conjugated
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
USD 509.00
2 Weeks
CNDP2 mouse monoclonal antibody, clone OTI6D3 (formerly 6D3), Biotinylated
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
CNDP2 mouse monoclonal antibody, clone OTI6D3 (formerly 6D3), HRP conjugated
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
CNDP2 mouse monoclonal antibody, clone OTI8A2 (formerly 8A2)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
CNDP2 mouse monoclonal antibody, clone OTI6D3 (formerly 6D3)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit Polyclonal Anti-CNDP2 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CNDP2 antibody: synthetic peptide directed towards the middle region of human CNDP2. Synthetic peptide located within the following region: LAGRRAMKTVFGVEPDLTREGGSIPVTLTFQEATGKNVMLLPVGSADDGA |
CNDP2 mouse monoclonal antibody, clone AT15E5, Purified
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
CNDP2 mouse monoclonal antibody, clone AT15E5, Purified
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-CNDP2 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CNDP2 antibody: synthetic peptide directed towards the middle region of human CNDP2. Synthetic peptide located within the following region: ALEAYQKTGQEIPVNVRFCLEGMEESGSEGLDELIFARKDTFFKDVDYVC |
CNDP2 Antibody - C-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human CNDP2 |