Antibodies

View as table Download

Rabbit Polyclonal Anti-PLG Antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human PLG

Rabbit polyclonal CATG (Cleaved-Ile21) antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human CATG.

Rabbit polyclonal PLMN (heavy chain A short form, Cleaved-Val98) antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human PLMN.

Rabbit Polyclonal Anti-F2 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-F2 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: CQLWRSRYPHRPDINSTTHPGADLKENFCRNPDSSTSGPWCYTTDPTVRR

Rabbit Polyclonal Anti-THRB Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-THRB Antibody: A synthesized peptide derived from human THRB

Rabbit Polyclonal Anti-Cathepsin G Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Cathepsin G Antibody: A synthesized peptide derived from human Cathepsin G