Rabbit Polyclonal Anti-CPE Antibody - N-terminal region
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CPE antibody: synthetic peptide directed towards the N terminal of human CPE. Synthetic peptide located within the following region: GMRRRRRLQQEDGISFEYHRYPELREALVSVWLQCTAISRIYTVGRSFEG |
Rabbit polyclonal anti-CPE antibody
| Applications | WB |
| Reactivities | Mouse, Rat, Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CPE.Purification: The antibody was affinity-purified from |
Rabbit anti-CPE Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CPE |
Rabbit Polyclonal Anti-Granzyme B Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Granzyme B Antibody: A synthesized peptide derived from human Granzyme B |
Germany
Japan
United Kingdom
China
