Antibodies

View as table Download

Rabbit Polyclonal Anti-Clcn5 Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Clcn5 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: LVVIMFELTGGLEYIVPLMAAAMTSKWVADALGREGIYDAHIRLNGYPFL

Rabbit anti-CLCN5 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human CLCN5