Rabbit polyclonal anti-GPR27 antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human GPR27. |
Rabbit polyclonal anti-GPR27 antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human GPR27. |
Rabbit Polyclonal Anti-GPR27 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GPR27 antibody: synthetic peptide directed towards the N terminal of human GPR27. Synthetic peptide located within the following region: MANASEPGGSGGGEAAALGLKLATLSLLLCVSLAGNVLFALLIVRERSLH |
Rabbit Polyclonal Anti-GPR27 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GPR27 antibody: synthetic peptide directed towards the middle region of human GPR27. Synthetic peptide located within the following region: LVCAAWALALAAAFPPVLDGGGDDEDAPCALEQRPDGAPGALGFLLLLAV |
Rabbit Polyclonal Anti-GPR27 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GPR27 antibody: synthetic peptide directed towards the middle region of human GPR27. Synthetic peptide located within the following region: AVTLLFLLLWGPYVVASYLRVLVRPGAVPQAYLTASVWLTFAQAGINPVV |