Antibodies

Jump to Filters
View as table Download
Frizzled 6 (FZD6) Rabbit Polyclonal Antibody
TA314727

USD 380.00

4 Weeks

Rabbit polyclonal anti-FZD6 antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human FZD6.
Frizzled 6 (FZD6) (Center) Rabbit Polyclonal Antibody
AP51749PU-N

USD 580.00

2 Weeks

Frizzled 6 (FZD6) (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 493-520 amino acids from the Central region of human FZD6
Frizzled 6 (FZD6) Rabbit Polyclonal Antibody
TA344064

USD 539.00

5 Days

Rabbit Polyclonal Anti-FZD6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FZD6 antibody: synthetic peptide directed towards the middle region of human FZD6. Synthetic peptide located within the following region: HKKKHYKPSSHKLKVISKSMGTSTGATANHGTSAVAITSHDYLGQETLTE