Antibodies

View as table Download

Rabbit polyclonal anti-PE2R3 antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human PE2R3.

Rabbit Polyclonal Anti-PTGER3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PTGER3 antibody: synthetic peptide directed towards the C terminal of human PTGER3. Synthetic peptide located within the following region: LDPWVYLLLRKILLRKFCQIRYHTNNYASSSTSLPCQCSSTLMWSDHLER

Goat Polyclonal Antibody against PTGER3

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence KLLREPCSVQLS, from the C Terminus of the protein sequence according to NP_000948.2; NP_942005.2; NP_942006.1.

Rabbit Polyclonal Anti-PTGER3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PTGER3 antibody: synthetic peptide directed towards the middle region of human PTGER3. Synthetic peptide located within the following region: STVIDPSRFCAQPFRWFLDLSFPAMSSSHPQLPLTLASFKLLREPCSVQL

Rabbit Polyclonal Anti-PTGER3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PTGER3 antibody: synthetic peptide directed towards the middle region of human PTGER3. Synthetic peptide located within the following region: QMRKRRLREQLICSLQNSQIQRATAHCGQVQTYRVLNREEMEVLVSSINV

Rabbit Polyclonal Anti-PTGER3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PTGER3 antibody: synthetic peptide directed towards the middle region of human PTGER3. Synthetic peptide located within the following region: ILDPWVYLLLRKILLRKFCQIRYHTNNYASSSTSLPCQCSSTLMWSDHLE