Antibodies

Jump to Filters
View as table Download
SDF1 (CXCL12) (alpha) Rabbit Polyclonal Antibody
PP1067P1

USD 345.00

2 Weeks

SDF1 (CXCL12) (alpha) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, FN, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Highly pure (>98%) E.coli derived recombinant Human SDF1-alpha (Cat.-No PA126)
SDF1 (CXCL12) (alpha) Rabbit Polyclonal Antibody
PP1067P2

USD 465.00

2 Weeks

SDF1 (CXCL12) (alpha) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, FN, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Highly pure (>98%) E.coli derived recombinant Human SDF1-alpha (Cat.-No PA126)
SDF1 (CXCL12) (alpha) Rabbit Polyclonal Antibody
PP1067B2

USD 465.00

2 Weeks

SDF1 (CXCL12) (alpha) rabbit polyclonal antibody, Biotin

Applications ELISA, WB
Reactivities Human
Conjugation Biotin
Immunogen Highly pure (>98%) E.coli derived recombinant Human SDF1-alpha (Cat.-No PA126)
SDF1 (CXCL12) Rabbit Polyclonal Antibody
AP20632PU-N

USD 465.00

3 Weeks

SDF1 (CXCL12) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to amino acids 50-100 of Human SDF-1.
SDF1 (CXCL12) (alpha) Rabbit Polyclonal Antibody
PP1067B1

USD 345.00

2 Weeks

SDF1 (CXCL12) (alpha) rabbit polyclonal antibody, Biotin

Applications ELISA, WB
Reactivities Human
Conjugation Biotin
Immunogen Highly pure (>98%) E.coli derived recombinant Human SDF1-alpha (Cat.-No PA126)
SDF1 (CXCL12) Rabbit Polyclonal Antibody
TA347900

USD 380.00

2 Weeks

Rabbit Polyclonal Anti-SDF 1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-SDF 1 Antibody: A synthesized peptide derived from human SDF 1
SDF1 (CXCL12) (beta) Goat Polyclonal Antibody
PP1068P1

USD 345.00

2 Weeks

SDF1 (CXCL12) (beta) goat polyclonal antibody, Aff - Purified

Applications ELISA, FN, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E. Coli derived Recombinant recombinant Human SDF-1 beta
SDF1 (CXCL12) (beta) Goat Polyclonal Antibody
PP1068P2

USD 465.00

2 Weeks

SDF1 (CXCL12) (beta) goat polyclonal antibody, Aff - Purified

Applications ELISA, FN, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E. Coli derived Recombinant recombinant Human SDF-1 beta
SDF1 (CXCL12) Rabbit Polyclonal Antibody
TA330383

USD 539.00

5 Days

Rabbit Polyclonal Anti-CXCL12 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-CXCL12 antibody: synthetic peptide directed towards the middle region of human CXCL12. Synthetic peptide located within the following region: VKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNKRFKM
SDF1 (CXCL12) (beta) Goat Polyclonal Antibody
PP1068B1

USD 345.00

2 Weeks

SDF1 (CXCL12) (beta) goat polyclonal antibody, Biotin

Applications ELISA, WB
Reactivities Human
Conjugation Biotin
Immunogen Highly pure (>98%) E.coli derived recombinant Human SDF1-beta.
SDF1 (CXCL12) (beta) Goat Polyclonal Antibody
PP1068B2

USD 465.00

2 Weeks

SDF1 (CXCL12) (beta) goat polyclonal antibody, Biotin

Applications ELISA, WB
Reactivities Human
Conjugation Biotin
Immunogen Highly pure (>98%) E.coli derived recombinant Human SDF1-beta.