Rabbit polyclonal antibody to IL16 (interleukin 16 (lymphocyte chemoattractant factor))
| Applications | IF, WB |
| Reactivities | Human (Predicted: Pig, Chimpanzee, Bovine, Rhesus Monkey) |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 1268 and 1332 of IL16 (Uniprot ID#Q14005) |
Rabbit Polyclonal Anti-IL16 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-IL16 antibody is: synthetic peptide directed towards the C-terminal region of Human IL16. Synthetic peptide located within the following region: EILQLGGTAMQGLTRFEAWNIIKALPDGPVTIVIRRKSLQSKETTAAGDS |
IL16 mouse monoclonal antibody, clone 59, Purified
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China
