Germany
Japan
United Kingdom
China
Antibodies
View as table Download
EGR2 mouse monoclonal antibody, clone OTI1B12 (formerly 1B12)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
USD 509.00
2 Weeks
Rabbit Polyclonal Anti-EGR2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EGR2 antibody: synthetic peptide directed towards the C terminal of human EGR2. Synthetic peptide located within the following region: PFACDYCGRKFARSDERKRHTKIHLRQKERKSSAPSASVPAPSTASCSGG |
Rabbit polyclonal EGR2 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human EGR2. |
Goat Polyclonal Antibody against EGR2
| Applications | WB |
| Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence HGTAGPDRKPFPC, from the internal region of the protein sequence according to NP_000390.2. |
Rabbit Polyclonal Anti-EGR2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EGR2 Antibody: A synthesized peptide derived from human EGR2 |
EGR2 mouse monoclonal antibody,clone OTI1F10
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Active filters
Category
-
Antibodies
- Primary Antibodies
Target Symbol
- EGR2
Reactivities
- Rat
Applications
- WB
Families
- Druggable Genome