Antibodies

Jump to Filters
View as table Download
TLR9 Mouse Monoclonal Antibody [Clone ID: 26C593.2]
TA337047

USD 605.00

Backordered

Mouse Monoclonal TLR9 Antibody (26C593.2)

Applications Block/Neutralize, CyTOF-ready, Dot, ELISA, FC, ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat, Canine, Equine, Primate
Conjugation Unconjugated
TLR9 Rabbit Polyclonal Antibody
TA331898

USD 539.00

5 Days

Rabbit Polyclonal Anti-TLR9 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-TLR9 Antibody: synthetic peptide directed towards the N terminal of human TLR9. Synthetic peptide located within the following region: VGGNCRRCDHAPNPCMECPRHFPQLHPDTFSHLSRLEGLVLKDSSLSWLN