Antibodies

View as table Download

PAPSS2 mouse monoclonal antibody, clone OTI3H10 (formerly 3H10)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PAPSS2 mouse monoclonal antibody,clone OTI6H10

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PAPSS2 mouse monoclonal antibody, clone OTI3H10 (formerly 3H10)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PAPSS2 mouse monoclonal antibody,clone OTI6H10

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PAPSS2 mouse monoclonal antibody, clone OTI3H10 (formerly 3H10), Biotinylated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

PAPSS2 mouse monoclonal antibody, clone OTI3H10 (formerly 3H10), HRP conjugated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

PAPSS2 mouse monoclonal antibody, clone OTI2E7 (formerly 2E7)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PAPSS2 mouse monoclonal antibody, clone OTI2E7 (formerly 2E7)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Anti-CBS Antibody

Applications IHC, WB
Reactivities Human, Rat, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-CBS antibody: synthetic peptide directed towards the N terminal of human CBS. Synthetic peptide located within the following region: RCIIVMPEKMSSEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNE

PAPSS2 mouse monoclonal antibody, clone OTI5H3 (formerly 5H3)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PAPSS2 mouse monoclonal antibody, clone OTI1E12 (formerly 1E12)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated