Antibodies

View as table Download

Mouse Monoclonal NAK Antibody (108A429)

Applications ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat, Bovine, Canine
Conjugation Unconjugated
TA336453 is a replacement of AM08296PU-N.

TBK1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human TBK1

Goat Polyclonal TBK1 (aa514-527) Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-TIETSLQDIDSRLS, from the C or N Terminus of the protein sequence according to NP_037386.1

Rabbit Polyclonal Anti-TBK1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TBK1 antibody: synthetic peptide directed towards the N terminal of human TBK1. Synthetic peptide located within the following region: EEETTTRHKVLIMEFCPCGSLYTVLEEPSNAYGLPESEFLIVLRDVVGGM

Rabbit Polyclonal Anti-TBK1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TBK1 antibody: synthetic peptide directed towards the middle region of human TBK1. Synthetic peptide located within the following region: QEGTHPKDRNVEKLQVLLNCMTEIYYQFKKDKAERRLAYNEEQIHKFDKQ