Antibodies

Jump to Filters
View as table Download
DGKZ Mouse Monoclonal Antibody [Clone ID: OTI1A6]
TA809946

USD 478.00

In Stock

DGKZ mouse monoclonal antibody,clone OTI1A6

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
DGKZ Mouse Monoclonal Antibody [Clone ID: OTI1A6]
CF809946

USD 600.00

3 Days

Carrier-free (BSA/glycerol-free) DGKZ mouse monoclonal antibody,clone OTI1A6

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
DGKB Mouse Monoclonal Antibody [Clone ID: OTI1F9]
TA501381

USD 447.00

In Stock

Anti-DGKB mouse monoclonal antibody, clone OTI1F9 (formerly 1F9)

Applications WB
Reactivities Human, Dog, Monkey, Mouse, Rat
Conjugation Unconjugated
DGKB Mouse Monoclonal Antibody [Clone ID: OTI1F9]
CF501381

USD 600.00

3 Days

Carrier-free (BSA/glycerol-free) DGKB mouse monoclonal antibody, clone OTI1F9 (formerly 1F9)

Applications WB
Reactivities Human, Dog, Monkey, Mouse, Rat
Conjugation Unconjugated
GPD2 Rabbit Polyclonal Antibody
TA351230

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-GPD2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human GPD2
Acetylcholinesterase (ACHE) Rabbit Polyclonal Antibody
TA350620

USD 380.00

In Stock

Rabbit Polyclonal Anti-ACHE Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human ACHE
PPAP2A (PLPP1) Rabbit Polyclonal Antibody
TA322830

USD 380.00

4 Weeks

Anti-PPAP2A Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 40-53 amino acids of human phosphatidic acid phosphatase type 2A
DGKB Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1F9]
TA501381BM

USD 509.00

2 Weeks

Anti-DGKB mouse monoclonal antibody, clone OTI1F9 (formerly 1F9), HRP conjugated

Applications WB
Reactivities Human, Dog, Monkey, Mouse, Rat
Conjugation HRP
Choline Acetyltransferase (CHAT) (N-term) Rabbit Polyclonal Antibody
AP50885PU-N

USD 580.00

2 Weeks

Choline Acetyltransferase (CHAT) (N-term) rabbit polyclonal antibody, Purified

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 98-128 amino acids from the N-terminal region of human CHAT.
Acetylcholinesterase (ACHE) Goat Polyclonal Antibody
TA302997

USD 520.00

5 Days

Goat Polyclonal Antibody against ACHE

Applications FC, IF, WB
Reactivities Human (Expected from sequence similarity: Mouse, Rat, Cow)
Conjugation Unconjugated
Immunogen Peptide with sequence QFDHYSKQDRCSDL, from the C Terminus of the protein sequence according to NP_000656.1.
Acetylcholinesterase (ACHE) Rabbit Polyclonal Antibody
TA345107

USD 539.00

5 Days

Rabbit Polyclonal Anti-ACHE Antibody - N-terminal region

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-ACHE antibody: synthetic peptide directed towards the N terminal of human ACHE. Synthetic peptide located within the following region: SMNYRVGAFGFLALPGSREAPGNVGLLDQRLALQWVQENVAAFGGDPTSV