Antibodies

Jump to Filters
View as table Download
ITGA8 (C-term) Rabbit Polyclonal Antibody
AP52252PU-N

USD 580.00

2 Weeks

ITGA8 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 1032-1061 amino acids from the C-terminal region of human ITGA8
ITGA8 Rabbit Polyclonal Antibody
TA338225

USD 539.00

5 Days

Rabbit Polyclonal Anti-ITGA8 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ITGA8 antibody: synthetic peptide directed towards the N terminal of human ITGA8. Synthetic peptide located within the following region: GEKQTEVAPASYDDSYLGYSVAAGEFTGDSQQELVAGIPRGAQNFGYVSI