Germany
Japan
United Kingdom
China
Carrier-free (BSA/glycerol-free) DVL2 mouse monoclonal antibody, clone OTI7F10 (formerly 7F10)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Antibodies
View as table Download
USD 509.00
2 Weeks
DVL2 mouse monoclonal antibody, clone OTI7A3 (formerly 7A3), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
USD 509.00
2 Weeks
DVL2 mouse monoclonal antibody, clone OTI7A3 (formerly 7A3), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
USD 509.00
2 Weeks
DVL2 mouse monoclonal antibody, clone OTI1E11 (formerly 1E11), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
USD 509.00
2 Weeks
DVL2 mouse monoclonal antibody, clone OTI1E11 (formerly 1E11), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
USD 509.00
2 Weeks
DVL2 mouse monoclonal antibody, clone OTI1B12 (formerly 1B12), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
USD 509.00
2 Weeks
DVL2 mouse monoclonal antibody, clone OTI1B12 (formerly 1B12), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
USD 509.00
2 Weeks
DVL2 mouse monoclonal antibody, clone OTI7F10 (formerly 7F10), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
USD 509.00
2 Weeks
DVL2 mouse monoclonal antibody, clone OTI7F10 (formerly 7F10), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
Rabbit Polyclonal Anti-DVL2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DVL2 antibody: synthetic peptide directed towards the N terminal of human DVL2. Synthetic peptide located within the following region: AGSSTGGGGVGETKVIYHLDEEETPYLVKIPVPAERITLGDFKSVLQRPA |
DVL2 mouse monoclonal antibody, clone OTI7C7 (formerly 7C7)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
DVL2 mouse monoclonal antibody, clone OTI2E11 (formerly 2E11)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Dishevelled 2 (DVL2) (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide between 587-617 amino acids from the C-terminal region of Human DVL2. |
Rabbit polyclonal anti-DVL2 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human DVL2. |
Rabbit Polyclonal Anti-DVL2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-DVL2 antibody is: synthetic peptide directed towards the middle region of Human DVL2. Synthetic peptide located within the following region: HRTGGPSRLERHLAGYESSSTLMTSELESTSLGDSDEEDTMSRFSSSTEQ |
Active filters
Target Symbol
- DISHEVELLED 2
Applications
- WB
Families
- Druggable Genome
Pathways
- Pathways in cancer