Antibodies

View as table Download

Rabbit Polyclonal Anti-SF3A1 Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SF3A1 antibody: synthetic peptide directed towards the N terminal of human SF3A1. Synthetic peptide located within the following region: QQTTQQQLPQKVQAQVIQETIVPKEPPPEFEFIADPPSISAFDLDVVKLT

Rabbit Polyclonal Anti-SF3A1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SF3A1 antibody: synthetic peptide directed towards the N terminal of human SF3A1. Synthetic peptide located within the following region: RQNEINNPKFNFLNPNDPYHAYYRHKVSEFKEGKAQEPSAAIPKVMQQQQ