Rabbit Polyclonal TCTN3 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | TCTN3 antibody was raised against a 17 amino acid synthetic peptide near the carboxy terminus of human TCTN3. |
Rabbit Polyclonal TCTN3 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | TCTN3 antibody was raised against a 17 amino acid synthetic peptide near the carboxy terminus of human TCTN3. |
Rabbit Polyclonal Anti-TCTN3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-TCTN3 Antibody: synthetic peptide directed towards the middle region of human TCTN3. Synthetic peptide located within the following region: LTYFPKWSVISLLRQPAGVGAGGLCAESNPAGFLESKSTTCTRFFKNLAS |