Antibodies

View as table Download

N4BP2L2 mouse monoclonal antibody, clone OTI1C8 (formerly 1C8)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) N4BP2L2 mouse monoclonal antibody, clone OTI1C8 (formerly 1C8)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

N4BP2L2 mouse monoclonal antibody, clone OTI1C8 (formerly 1C8)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

N4BP2L2 mouse monoclonal antibody, clone OTI1E2 (formerly 1E2)

Applications WB
Reactivities Human
Conjugation Unconjugated

N4BP2L2 mouse monoclonal antibody, clone OTI3G7 (formerly 3G7)

Applications WB
Reactivities Human
Conjugation Unconjugated

N4BP2L2 mouse monoclonal antibody, clone OTI5A3 (formerly 5A3)

Applications WB
Reactivities Human
Conjugation Unconjugated

N4BP2L2 mouse monoclonal antibody, clone OTI7F5 (formerly 7F5)

Applications WB
Reactivities Human
Conjugation Unconjugated

N4BP2L2 mouse monoclonal antibody, clone OTI3F12 (formerly 3F12)

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) N4BP2L2 mouse monoclonal antibody, clone OTI1E2 (formerly 1E2)

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) N4BP2L2 mouse monoclonal antibody, clone OTI3G7 (formerly 3G7)

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) N4BP2L2 mouse monoclonal antibody, clone OTI5A3 (formerly 5A3)

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) N4BP2L2 mouse monoclonal antibody, clone OTI7F5 (formerly 7F5)

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) N4BP2L2 mouse monoclonal antibody, clone OTI3F12 (formerly 3F12)

Applications WB
Reactivities Human
Conjugation Unconjugated

Rabbit polyclonal anti-N4BP2L2 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human N4BP2L2.

Rabbit Polyclonal Anti-N4BP2L2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-N4BP2L2 Antibody: synthetic peptide directed towards the N terminal of human N4BP2L2. Synthetic peptide located within the following region: EYQMSISIVMNSVEPSHKSTQRPPPPQGRQRERVLKKTGHRLSKTKQKRN