N4BP2L2 mouse monoclonal antibody, clone OTI1C8 (formerly 1C8)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
N4BP2L2 mouse monoclonal antibody, clone OTI1C8 (formerly 1C8)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) N4BP2L2 mouse monoclonal antibody, clone OTI1C8 (formerly 1C8)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
N4BP2L2 mouse monoclonal antibody, clone OTI1C8 (formerly 1C8)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
N4BP2L2 mouse monoclonal antibody, clone OTI1E2 (formerly 1E2)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
N4BP2L2 mouse monoclonal antibody, clone OTI3G7 (formerly 3G7)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
N4BP2L2 mouse monoclonal antibody, clone OTI5A3 (formerly 5A3)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
N4BP2L2 mouse monoclonal antibody, clone OTI7F5 (formerly 7F5)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
N4BP2L2 mouse monoclonal antibody, clone OTI3F12 (formerly 3F12)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) N4BP2L2 mouse monoclonal antibody, clone OTI1E2 (formerly 1E2)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) N4BP2L2 mouse monoclonal antibody, clone OTI3G7 (formerly 3G7)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) N4BP2L2 mouse monoclonal antibody, clone OTI5A3 (formerly 5A3)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) N4BP2L2 mouse monoclonal antibody, clone OTI7F5 (formerly 7F5)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) N4BP2L2 mouse monoclonal antibody, clone OTI3F12 (formerly 3F12)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit polyclonal anti-N4BP2L2 antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human N4BP2L2. |
Rabbit Polyclonal Anti-N4BP2L2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-N4BP2L2 Antibody: synthetic peptide directed towards the N terminal of human N4BP2L2. Synthetic peptide located within the following region: EYQMSISIVMNSVEPSHKSTQRPPPPQGRQRERVLKKTGHRLSKTKQKRN |