Antibodies

Jump to Filters
View as table Download
ST2 (IL1RL1) Rabbit Polyclonal Antibody
TA321605

USD 380.00

In Stock

Anti-IL1RL1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 250 amino acids of human interleukin 1 receptor-like 1
ST2 (IL1RL1) Rabbit Polyclonal Antibody
TA321604

USD 380.00

4 Weeks

Anti-IL1RL1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 250 amino acids of human interleukin 1 receptor-like 1
ST2 (IL1RL1) Rabbit Polyclonal Antibody
TA342005

USD 539.00

5 Days

Rabbit Polyclonal Anti-IL1RL1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IL1RL1 antibody: synthetic peptide directed towards the N terminal of human IL1RL1. Synthetic peptide located within the following region: RQGKPSYTVDWYYSQTNKSIPTQERNRVFASGQLLKFLPAAVADSGIYTC
ST2 (IL1RL1) Rabbit Polyclonal Antibody
TA337037

USD 550.00

5 Days

Rabbit Polyclonal IL1RL1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to amino acids 207-238 of human ST2V was used as immunogen, GenBank no BAA85894.