Antibodies

View as table Download

Rabbit polyclonal anti-MT-ND5 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human MT-ND5.

Rabbit Polyclonal Anti-ND5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ND5 antibody: synthetic peptide directed towards the N terminal of human ND5. Synthetic peptide located within the following region: SIVASTFIISLFPTTMFMCLDQEVIISNWHWATTQTTQLSLSFKLDYFSM