Rabbit polyclonal UBE3C Antibody (Center)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This UBE3C antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 549-578 amino acids from the Central region of human UBE3C. |
Rabbit Polyclonal Anti-UBE3C Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-UBE3C antibody is: synthetic peptide directed towards the N-terminal region of Human UBE3C. Synthetic peptide located within the following region: MFSFEGDFKTRPKVSLGGASRKYSIQRSAFDRCATLSQSGGAFPIANGPN |
Germany
Japan
United Kingdom
China