Antibodies

View as table Download

Rabbit polyclonal anti-CSK antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CSK.

Rabbit polyclonal anti-CSK Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human CSK

Goat Polyclonal Antibody against CSK

Applications WB
Reactivities Human, Mouse, Rat (Expected from sequence similarity: Dog, Cow)
Conjugation Unconjugated
Immunogen Peptide with sequence C-EQLEHIKTHELHL, from the C Terminus of the protein sequence according to NP_004374.1.

Rabbit Polyclonal Anti-CSK Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-CSK antibody: synthetic peptide directed towards the middle region of human CSK. Synthetic peptide located within the following region: SEDNVAKVSDFGLTKEASSTQDTGKLPVKWTAPEALREKKFSTKSDVWSF