Antibodies

Jump to Filters
View as table Download
POLR1B Rabbit Polyclonal Antibody
TA346803

USD 539.00

In Stock

Rabbit Polyclonal Anti-POLR1B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-POLR1B antibody: synthetic peptide directed towards the middle region of human POLR1B. Synthetic peptide located within the following region: SDKFQVRTTGARDRVTNQPIGGRNVQGGIRFGEMERDALLAHGTSFLLHD
POLR1B Rabbit Polyclonal Antibody
TA315900

USD 380.00

4 Weeks

Rabbit polyclonal anti-POLR1B antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human POLR1B.