Antibodies

Jump to Filters
View as table Download
RSK3 (RPS6KA2) Rabbit Polyclonal Antibody
TA309234

USD 545.00

In Stock

Rabbit Anti-Ribosomal S6 kinase 2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to amino acid residues from the C-terminal region conjugated to KLH
RSK3 (RPS6KA2) Rabbit Polyclonal Antibody
TA335494

USD 539.00

5 Days

Rabbit Polyclonal Anti-RPS6KA2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-RPS6KA2 Antibody: synthetic peptide directed towards the middle region of human RPS6KA2. Synthetic peptide located within the following region: LSRQDVHLVKGAMAATYFALNRTPQAPRLEPVLSSNLAQRRGMKRLTSTR