Rabbit Polyclonal Anti-IDUA Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Idua antibody is: synthetic peptide directed towards the middle region of MOUSE Idua. Synthetic peptide located within the following region: MENQLLPGFELMGSPSGYFTDFDDKQQVFEWKDLVSLLARRYIGRYGLTH |
Rabbit Polyclonal Anti-IDUA Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-IDUA antibody is: synthetic peptide directed towards the C-terminal region of Human IDUA. Synthetic peptide located within the following region: DPVAAAPRPLPAGGRLTLRPALRLPSLLLVHVCARPEKPPGQVTRLRALP |
Germany
Japan
United Kingdom
China