Antibodies

Jump to Filters
View as table Download
OR8I2 Rabbit Polyclonal Antibody
TA316047

USD 380.00

4 Weeks

Rabbit polyclonal anti-OR8I2 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human OR8I2.
OR8I2 Rabbit Polyclonal Antibody
TA332336

USD 539.00

5 Days

Rabbit Polyclonal Anti-OR8I2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-OR8I2 Antibody is: synthetic peptide directed towards the C-terminal region of Human OR8I2. Synthetic peptide located within the following region: YGSLIFTYLQPDNTSSLTQAQVASVFYTIVIPMLNPLIYSLRNKDVKNAL