Antibodies

Jump to Filters
View as table Download
OR5M9 Rabbit Polyclonal Antibody
TA316426

USD 380.00

4 Weeks

Rabbit polyclonal anti-OR5M9 antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human OR5M9.
OR5M9 Rabbit Polyclonal Antibody
TA337548

USD 539.00

5 Days

Rabbit Polyclonal Anti-OR5M9 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-OR5M9 antibody is: synthetic peptide directed towards the C-terminal region of Human OR5M9. Synthetic peptide located within the following region: YLRRPTEESVEQGKMVAVFYTTVIPMLNPMIYSLRNKDVKEAVNKAITKT