Antibodies

Jump to Filters
View as table Download
OR2H3 (OR2H2) Rabbit Polyclonal Antibody
TA314707

USD 380.00

In Stock

Rabbit polyclonal anti-OR2H2 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human OR2H2.
OR2H3 (OR2H2) Rabbit Polyclonal Antibody
TA342712

USD 539.00

5 Days

Rabbit Polyclonal Anti-OR2H2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-OR2H2 antibody: synthetic peptide directed towards the C terminal of human OR2H2. Synthetic peptide located within the following region: SLILVSYGAITWAVLRINSAKGRRKAFGTCSSHLTVVTLFYSSVIAVYLQ
OR2H3 (OR2H2) Rabbit Polyclonal Antibody
TA342713

USD 539.00

5 Days

Rabbit Polyclonal Anti-OR2H2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-OR2H2 antibody: synthetic peptide directed towards the C terminal of human OR2H2. Synthetic peptide located within the following region: FCPDRQVDDFVCEVPALIRLSCEDTSYNEIQVAVASVFILVVPLSLILVS