Antibodies

Jump to Filters
View as table Download
OR10R2 Rabbit Polyclonal Antibody
TA316369

USD 380.00

In Stock

Rabbit polyclonal anti-OR10R2 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human OR10R2.
OR10R2 Rabbit Polyclonal Antibody
TA332320

USD 539.00

5 Days

Rabbit Polyclonal Anti-OR10R2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-OR10R2 Antibody is: synthetic peptide directed towards the C-terminal region of Human OR10R2. Synthetic peptide located within the following region: VPFLFICVSYLCILRTILKIPSAEGRRKAFSTCASHLSVVIVHYGCASFI